PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000954G0350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family M-type_MADS
Protein Properties Length: 377aa    MW: 41650.9 Da    PI: 9.1902
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000954G0350genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.88.1e-201664149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     kri+n+  rqv fskRr+  +KKA+ELS+LC+ae+a ++fs+ gk + +
  PH01000954G0350 16 KRIQNEEARQVAFSKRRTSTFKKANELSILCGAEIAAVVFSPAGKAFSF 64
                     79******************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-30867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.693868IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-25980IPR002100Transcription factor, MADS-box
CDDcd002651.01E-32980No hitNo description
PRINTSPR004041.6E-191030IPR002100Transcription factor, MADS-box
PfamPF003194.7E-221764IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-193045IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-194566IPR002100Transcription factor, MADS-box
PfamPF077383.4E-7314362IPR012919SUN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MVKARPSLGR RKIEIKRIQN EEARQVAFSK RRTSTFKKAN ELSILCGAEI AAVVFSPAGK  60
AFSFGHPSVD TVMNRFLNTS CKVGAIMGSG SQGNAETLPT PRGLQLEIDE INNLVEVEKL  120
KGKQLDNEIG SNCDERVLRW FHSGAKALGL NELEDIQKEL VALKSAVQLE PIDREIDGQV  180
RAARAKLAAL LKEKILDFKS QLRQLNTRTD KLNDVMRGIK RMEFLSNGEF EKFWNEVRES  240
LGSGSWIYVD LDQVRTLARE IAMRKIEKHA ANGIGKVDYA MASAGGRVVC YSTAYDASHR  300
GILSAFLGGD YGDPQKMLQP SFGEPRQCFA FQGSSGFLEI KLRKGIVLVA ITVEHVSKVL  360
SASMFASVMC LDIFED*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693716.12e-81PREDICTED: protein SAD1/UNC-84 domain protein 1-like
TrEMBLJ3KYM14e-80J3KYM1_ORYBR; Uncharacterized protein
STRINGOB01G20770.11e-79(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36590.13e-28M-type_MADS family protein